PDB entry 3a1r

View 3a1r on RCSB PDB site
Description: Neutron crystal structure analysis of bovine pancreatic ribonuclease A
Class: hydrolase
Keywords: Bovine pancreatic ribonuclease A, Neutron structure, Endonuclease, glycation, Glycoprotein, hydrolase, Secreted, Disulfide bond, Nuclease
Deposited on 2009-04-21, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a1ra_
  • Heterogens: DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a1rA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv