PDB entry 3a12

View 3a12 on RCSB PDB site
Description: Crystal structure of Type III Rubisco complexed with 2-CABP
Class: lyase
Keywords: ribulose-1, 5-bisphosphate carboxylase/oxygenase, Rubisco, LYASE, Carbon dioxide fixation, Magnesium, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2009-03-25, released 2010-04-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12a1, d3a12a2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12b1, d3a12b2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12c1, d3a12c2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12d1, d3a12d2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12e1, d3a12e2
  • Chain 'F':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12f1, d3a12f2
  • Chain 'G':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12g1, d3a12g2
  • Chain 'H':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12h1, d3a12h2
  • Chain 'I':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12i1, d3a12i2
  • Chain 'J':
    Compound: Ribulose bisphosphate carboxylase
    Species: Pyrococcus kodakaraensis [TaxId:69014]
    Gene: rbcL, TK2290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a12j1, d3a12j2
  • Heterogens: MG, CAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a12A (A:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12A (A:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a12B (B:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12B (B:)
    tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
    wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
    yfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngad
    ymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevlad
    lglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyr
    ligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafpts
    sgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyak
    thkelaralekwghvtpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3a12C (C:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12C (C:)
    tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
    wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
    yfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngad
    ymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevlad
    lglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyr
    ligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafpts
    sgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyak
    thkelaralekwghvtpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a12D (D:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12D (D:)
    ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
    dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
    peklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadym
    kddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlg
    lkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrli
    gidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssg
    glhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakth
    kelaralekwghvtpv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a12E (E:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12E (E:)
    tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
    wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
    yfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngad
    ymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevlad
    lglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyr
    ligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafpts
    sgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyah
    kelaralekwghvtpv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a12F (F:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12F (F:)
    ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttypwyeqerwad
    lsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfp
    eklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymk
    ddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlgl
    khamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrlig
    idqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgg
    lhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthk
    elaralekwghvtpv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3a12G (G:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12G (G:)
    ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
    dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
    peklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadym
    kddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlg
    lkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrli
    gidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssg
    glhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakth
    kelaralekwghvtpv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3a12H (H:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12H (H:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3a12I (I:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12I (I:)
    ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
    dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
    peklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadym
    kddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlg
    lkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrli
    gidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssg
    glhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakth
    kelaralekwghvtpv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3a12J (J:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a12J (J:)
    iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
    adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
    fpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngady
    mkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladl
    glkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrl
    igidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptss
    gglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakt
    hkelaralekwghvtpv