PDB entry 3a10

View 3a10 on RCSB PDB site
Description: Crystal structure of response regulator protein TrrA (TM1360) from Thermotoga maritima in complex with Mg(2+)-BeF (SeMet, L89M)
Class: signaling protein
Keywords: phosphoacceptor, SIGNALING PROTEIN
Deposited on 2009-03-25, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.203
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Response regulator
  Species: Thermotoga maritima [TaxId:2336]
  Gene: TM_1360
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9X181 (0-115)
    • engineered (88)
  Domains in SCOPe 2.06: d3a10a_
• Heterogens: MG, BEF, PG4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3a10A (A:)
  mkrilvvddepnirellkeelqeegyeidtaengeealkkffsgnydlvildiempgisg
  levageirkkkkdakiilltayshyrsdmsswaadeyvvksfnfdelkekvkklls