PDB entry 2zzp

View 2zzp on RCSB PDB site
Description: The crystal structure of human Atg4B(C74S)- LC3(1-124) complex
Class: hydrolase/structural protein
Keywords: papain-like fold, ubiquitin fold, Alternative splicing, Autophagy, Cytoplasm, Hydrolase, Phosphoprotein, Polymorphism, Protease, Protein transport, Thiol protease, Transport, Ubl conjugation pathway, Cytoplasmic vesicle, Lipoprotein, Membrane, Microtubule, HYDROLASE/STRUCTURAL PROTEIN COMPLEX
Deposited on 2009-02-22, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine protease ATG4B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4P1 (Start-356)
      • engineered (76)
    Domains in SCOPe 2.07: d2zzpa_
  • Chain 'B':
    Compound: Microtubule-associated proteins 1A/1B light chain 3B
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zzpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zzpA (A:)
    gphmdaatltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrkn
    fpaiggtgptsdtgwgsmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafid
    rkdsyysihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvme
    eirrlcrtsvpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdine
    ayvetlkhcfmmpqslgviggkpnsahyfigyvgeeliyldphttqpaveptdgcfipde
    sfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zzpA (A:)
    ltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggtg
    ptsdtgwgsmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyysi
    hqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcrt
    spwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvgeeliy
    ldphttqpavepipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkklsl
    lalpmfelveq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zzpB (B:)
    gplgsmpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvp
    dhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyas
    qetfgtala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zzpB (B:)
    ektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
    ikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfgta