PDB entry 2zxy

View 2zxy on RCSB PDB site
Description: Crystal Structure of Cytochrome c555 from Aquifex aeolicus
Class: oxygen binding, transport protein
Keywords: heme protein, oxygen binding, transport protein
Deposited on 2009-01-09, released 2009-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.129
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c552
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: cycB2, aq_1550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zxya_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2zxyA (A:)
adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
mkpqltmlkglsdaelkaladfilshk

    Sequence, based on observed residues (ATOM records): (download) 
    >2zxyA (A:)
adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
mkpqltmlkglsdaelkaladfilsh