PDB entry 2zxw

View 2zxw on RCSB PDB site
Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Electron transport, Formylation, Heme, Iron, Membrane, Metal-binding, Mitochondrion, Mitochondrion inner membrane, Respiratory chain, Transmembrane, Transport, Transit peptide
Deposited on 2009-01-08, released 2009-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwa_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwb1, d2zxwb2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwc_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwd_
  • Chain 'E':
    Compound: Cytochrome c oxidase subunit 5A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwe_
  • Chain 'F':
    Compound: Cytochrome c oxidase subunit 5B
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwf_
  • Chain 'G':
    Compound: cytochrome c oxidase polypeptide 6a2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwg_
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwh_
  • Chain 'I':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwi_
  • Chain 'J':
    Compound: Cytochrome c oxidase polypeptide 7A1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwj_
  • Chain 'K':
    Compound: cytochrome c oxidase polypeptide 7b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwk_
  • Chain 'L':
    Compound: Cytochrome c oxidase subunit 7C
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwl_
  • Chain 'M':
    Compound: cytochrome c oxidase polypeptide 8h
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwm_
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwn_
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwo1, d2zxwo2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwp_
  • Chain 'Q':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwq_
  • Chain 'R':
    Compound: Cytochrome c oxidase subunit 5A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwr_
  • Chain 'S':
    Compound: Cytochrome c oxidase subunit 5B
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxws_
  • Chain 'T':
    Compound: cytochrome c oxidase polypeptide 6a2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwt_
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwu_
  • Chain 'V':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwv_
  • Chain 'W':
    Compound: Cytochrome c oxidase polypeptide 7A1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxww_
  • Chain 'X':
    Compound: cytochrome c oxidase polypeptide 7b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwx_
  • Chain 'Y':
    Compound: Cytochrome c oxidase subunit 7C
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwy_
  • Chain 'Z':
    Compound: cytochrome c oxidase polypeptide 8h
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxwz_
  • Heterogens: CU, PER, MG, NA, HEA, PGV, CUA, TGL, PSC, CHD, DMU, UNX, PEK, CDL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zxwA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zxwB (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zxwC (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwC (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zxwD (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zxwE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwE (E:)
    etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
    rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zxwF (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwF (F:)
    ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
    ednstviwfwlhkgeaqrcpscgthyklvphql
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zxwG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zxwH (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwH (H:)
    yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
    twddrraegtfpgki
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2zxwI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwI (I:)
    alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
    mrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2zxwJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfph
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2zxwK (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2zxwL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwL (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2zxwM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zxwN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zxwO (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2zxwP (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwP (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2zxwQ (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2zxwR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwR (R:)
    etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
    rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2zxwS (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwS (S:)
    ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
    ednstviwfwlhkgeaqrcpscgthyklvphql
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2zxwT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2zxwU (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwU (U:)
    yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
    twddrraegtfpgki
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2zxwV (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwV (V:)
    alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
    mrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2zxwW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfph
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2zxwX (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwX (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2zxwY (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwY (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2zxwZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxwZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks