PDB entry 2zwm

View 2zwm on RCSB PDB site
Description: Crystal structure of YycF receiver domain from Bacillus subtilis
Class: Transcription
Keywords: two-component system, response regulator, dimerization domain, phosphorylation site, Cytoplasm, DNA-binding, Phosphoprotein, Transcription, Transcription regulation, Two-component regulatory system
Deposited on 2008-12-16, released 2009-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein yycF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zwma_
  • Chain 'B':
    Compound: Transcriptional regulatory protein yycF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zwmb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zwmA (A:)
    mdkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkd
    gvevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrq
    ltlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zwmA (A:)
    dkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkdg
    vevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zwmB (B:)
    mdkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkd
    gvevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrq
    ltlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zwmB (B:)
    dkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkdg
    vevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrql