PDB entry 2zwj

View 2zwj on RCSB PDB site
Description: Crystal structure of a hemoglobin component V from Propsilocerus akamusi (pH4.6 coordinates)
Class: oxygen transport
Keywords: hemoglobin, insect, Diptera, Propsilocerus akamusi, midge larva, Heme, Oxygen transport, Transport
Deposited on 2008-12-13, released 2009-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin v
  Species: Tokunagayusurika akamusi [TaxId:28383]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M422 (0-151)
  Domains in SCOPe 2.05: d2zwja_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zwjA (A:)
  afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
  anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
  ldsthgaawnkmmdnffyvfyecldgrcsqfs