PDB entry 2zur

View 2zur on RCSB PDB site
Description: Crystal Structure of Rh(nbd)/apo-Fr
Class: Metal Binding Protein
Keywords: Metal Binding Protein, Acetylation, Iron, Iron storage, Metal-binding
Deposited on 2008-10-28, released 2009-06-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2zurx_
  • Heterogens: CD, SO4, RH, EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2zurX (X:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvxhffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zurX (X:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvxhffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh