PDB entry 2zt9

View 2zt9 on RCSB PDB site
Description: Crystal Structure of the Cytochrome b6f Complex from Nostoc sp. PCC 7120
Class: photosynthesis
Keywords: PHOTOSYNTHESIS, CYTOCHROME B6F COMPLEX, heme b,2Fe-2S PROTEIN, CYTOCHROME F
Deposited on 2008-09-27, released 2009-02-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zt9a_
  • Chain 'B':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zt9b_
  • Chain 'C':
    Compound: Apocytochrome f
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cytochrome b6-f complex iron-sulfur subunit 1
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cytochrome b6-f complex subunit 6
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cytochrome b6-f complex subunit 7
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zt9f_
  • Chain 'G':
    Compound: Cytochrome b6-f complex subunit 5
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Cytochrome b6-f complex subunit 8
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zt9h_
  • Heterogens: HEM, UMQ, CLA, OPC, SQD, FES, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zt9A (A:)
    manvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykp
    tvaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvs
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmlfhflmirkqgisgpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zt9B (B:)
    mathkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpa
    mtgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkf
    qnpfrrpvattvflfgtlvtlwlgigaalpldksltlglf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zt9F (F:)
    msgellnaallsfglifvgwalgalllkiqgaee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zt9F (F:)
    msgellnaallsfglifvgwalgalllkiqga
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zt9H (H:)
    mailtlgwvsllvvftwsiamvvwgrngl