PDB entry 2zst

View 2zst on RCSB PDB site
Description: Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser on [450 min]
Class: oxygen transport
Keywords: haem protein, myoglobin, ligand migration, photodissociation, OXYGEN TRANSPORT
Deposited on 2008-09-17, released 2009-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.166
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOPe 2.06: d2zsta_
• Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zstA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg