PDB entry 2zsc

View 2zsc on RCSB PDB site
Description: Tamavidin2, Novel Avidin-like Biotin-Binding Proteins from an Edible Mushroom
Class: Biotin Binding Protein
Keywords: Biotin Binding Protein, Avidin-like structure
Deposited on 2008-09-05, released 2009-02-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.201
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tamavidin2
    Species: Pleurotus cornucopiae [TaxId:5321]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2zsca_
  • Chain 'B':
    Compound: Tamavidin2
    Species: Pleurotus cornucopiae [TaxId:5321]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2zscb_
  • Heterogens: GOL, BTN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zscA (A:)
    msdvqssltgtwynelnskmeltankdgtltgkylskvgdvyvpyplsgrynlqppagqg
    valgwavswenskihsattwsgqffsesspviltqwllssstargdvwestlvgndsftk
    tapteqqiahaqlhcraprlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zscA (A:)
    sdvqssltgtwynelnskmeltankdgtltgkylskvgdvyvpyplsgrynlqppagqgv
    algwavswenskihsattwsgqffsesspviltqwllssstargdvwestlvgndsftkt
    apt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zscB (B:)
    msdvqssltgtwynelnskmeltankdgtltgkylskvgdvyvpyplsgrynlqppagqg
    valgwavswenskihsattwsgqffsesspviltqwllssstargdvwestlvgndsftk
    tapteqqiahaqlhcraprlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zscB (B:)
    sdvqssltgtwynelnskmeltankdgtltgkylskvgdvyvpyplsgrynlqppagqgv
    algwavswenskihsattwsgqffsesspviltqwllssstargdvwestlvgndsftkt
    apt