PDB entry 2zsa

View 2zsa on RCSB PDB site
Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with ADP and Phosphopantothenate
Class: Transferase
Keywords: Transferase, homodimer, COA biosynthesis, nucleotide binding, ATP-binding, Coenzyme A biosynthesis, Kinase
Deposited on 2008-09-04, released 2009-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pantothenate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaA (Rv1092c)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zsaa_
  • Heterogens: ADP, PAZ, GOL, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zsaA (A:)
    msrlsepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarli
    hlqvaarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhh
    prvdlvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshl
    hydiipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrfl
    amrttafadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkda
    dhsinrlrlrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zsaA (A:)
    epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
    arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
    vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
    pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
    afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
    rlrlrkl