PDB entry 2zrs

View 2zrs on RCSB PDB site
Description: Crystal structure of Ca2+-bound form of des3-23ALG-2
Class: apoptosis
Keywords: Penta-EF-hand protein, Calcium-binding protein, APOPTOSIS, Calcium, Endoplasmic reticulum, Membrane, Nucleus, Polymorphism
Deposited on 2008-09-01, released 2008-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.228
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrsa_
  • Chain 'B':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrsb_
  • Chain 'C':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrsc_
  • Chain 'D':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrsd_
  • Chain 'E':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrse_
  • Chain 'F':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrsf_
  • Chain 'G':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrsg_
  • Chain 'H':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zrsh_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zrsA (A:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsA (A:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zrsB (B:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsB (B:)
    sflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfsef
    tgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgq
    iafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zrsC (C:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsC (C:)
    flwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfseft
    gvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgqi
    afddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zrsD (D:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsD (D:)
    qsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfse
    ftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrg
    qiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zrsE (E:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsE (E:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zrsF (F:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsF (F:)
    sflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfsef
    tgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgq
    iafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zrsG (G:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsG (G:)
    sflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfsef
    tgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgq
    iafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zrsH (H:)
    dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrsH (H:)
    sflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfsef
    tgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgq
    iafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf