PDB entry 2zr8

View 2zr8 on RCSB PDB site
Description: Crystal Structure of Modified Serine Racemase complexed with Serine
Class: isomerase
Keywords: PLP-dependent, Lyase, Pyridoxal phosphate, ISOMERASE
Deposited on 2008-08-25, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein C320.14
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zr8a_
  • Heterogens: PDD, SER, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zr8A (A:)
    msdnlvlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrg
    alnalsqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyg
    gqvimydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfv
    clggggllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtq
    hlgnytfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklkn
    krigiiisggnvdieryahflsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zr8A (A:)
    lvlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrgalna
    lsqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyggqvi
    mydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfvclgg
    ggllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtqhlgn
    ytfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklknkrig
    iiisggnvdieryahflsq