PDB entry 2zqy

View 2zqy on RCSB PDB site
Description: T-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Rossmann fold, Cytoplasm, Glycolysis, NAD, Phosphoprotein
Deposited on 2008-08-22, released 2009-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zqya1, d2zqya2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zqyb1, d2zqyb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zqyc1, d2zqyc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zqyd1, d2zqyd2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqyA (A:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqyA (A:)
    qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
    eysdakdadlvvitagapgetrldlvnknlkilksivdpivdsgfngiflvaanpvdilt
    yatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwsha
    niggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskailn
    denavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkkv
    ltdaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zqyB (B:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqyB (B:)
    qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
    eysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaanpvd
    iltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvw
    shaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariska
    ilndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasql
    kkvltdaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zqyC (C:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqyC (C:)
    qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
    eysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaanpvd
    iltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvw
    shaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariska
    ilndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasql
    kkvltdafakndietr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zqyD (D:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqyD (D:)
    qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
    eysdakdadlvvitagapgetrldlvnknlkilksivdpivdsgfngiflvaanpvdilt
    yatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwsha
    niggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskailn
    denavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkkv
    ltdaf