PDB entry 2zpu

View 2zpu on RCSB PDB site
Description: Crystal Structure of Modified Serine Racemase from S.pombe.
Class: isomerase
Keywords: PLP-dependent, Lyase, Pyridoxal phosphate, ISOMERASE
Deposited on 2008-07-29, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein C320.14
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPCC320.14, SPCC330.15c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zpua_
  • Heterogens: MG, PDD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zpuA (A:)
    msdnlvlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrg
    alnalsqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyg
    gqvimydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfv
    clggggllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtq
    hlgnytfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklkn
    krigiiisggnvdieryahflsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpuA (A:)
    lvlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrgalna
    lsqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyggqvi
    mydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfvclgg
    ggllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtqhlgn
    ytfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklknkrig
    iiisggnvdieryahflsq