PDB entry 2zon

View 2zon on RCSB PDB site
Description: Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
Class: OXIDOREDUCTASE/electron transport
Keywords: nitrite, electron transfer, denitrification, OXIDOREDUCTASE-electron transport COMPLEX
Deposited on 2008-05-27, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zona1, d2zona2
  • Chain 'B':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zonb1, d2zonb2
  • Chain 'C':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zonc1, d2zonc2
  • Chain 'G':
    Compound: cytochrome c551
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZON (Start-86)
    Domains in SCOPe 2.07: d2zong_
  • Heterogens: CU, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zonA (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zonA (A:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zonB (B:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zonB (B:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zonC (C:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zonC (C:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapip
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zonG (G:)
    aadapaqldpageklyrsacvvchasgvanapklgdkqawapflaqgadallatvlkgkg
    ampprggtaadeatlraavaymmdaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zonG (G:)
    qldpageklyrsacvvchasgvanapklgdkqawapflaqgadallatvlkgkgampprg
    gtaadeatlraavaymmdaar