PDB entry 2zol

View 2zol on RCSB PDB site
Description: Crystal structure of H-2Db in complex with the W513S variant of JHMV epitope S510
Class: immune system
Keywords: Immune System, Ig fold, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Polymorphism, Secreted, Cleavage on pair of basic residues, Coiled coil, Envelope protein, Fusion protein, Host-virus interaction, Virion, Virulence
Deposited on 2008-05-22, released 2008-06-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.256
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zola1, d2zola2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zolb_
  • Chain 'C':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zolc1, d2zolc2
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zold_
  • Chain 'E':
    Compound: 9-meric peptide from Spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02385 (0-8)
      • modified residue (0)
      • engineered (3)
  • Chain 'F':
    Compound: 9-meric peptide from Spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02385 (0-8)
      • modified residue (0)
      • engineered (3)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zolA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwerwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zolA (A:)
    phsmryfetavsrpgepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywere
    tqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrdy
    ialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllrtd
    spkahvthhprskgevtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvplqn
    ytcrvyheglpepltlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zolB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zolB (B:)
    qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
    fyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zolC (C:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwerwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zolC (C:)
    phsmryfetavsrpgepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywere
    tqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrdy
    ialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllrtd
    spkahvthhprskgevtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvqnyt
    crvyheglpepltlrw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zolD (D:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zolD (D:)
    qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
    fyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.