PDB entry 2zok

View 2zok on RCSB PDB site
Description: Crystal structure of H-2Db in complex with JHMV epitope S510
Class: immune system
Keywords: Immune System, Ig fold, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted, Cleavage on pair of basic residues, Envelope protein, Fusion protein, Host-virus interaction, Virion, Virulence
Deposited on 2008-05-22, released 2008-06-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01899 (Start-274)
      • expression tag (275)
    Domains in SCOPe 2.01: d2zoka1, d2zoka2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zokb_
  • Chain 'C':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zokc1, d2zokc2
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zokd_
  • Chain 'E':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01899 (Start-274)
      • expression tag (275)
    Domains in SCOPe 2.01: d2zoke1, d2zoke2
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zokf_
  • Chain 'G':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zokg1, d2zokg2
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zokh_
  • Chain 'I':
    Compound: 9-meric peptide from Spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02385 (0-8)
      • modified residue (0)
  • Chain 'J':
    Compound: 9-meric peptide from Spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02385 (0-8)
      • modified residue (0)
  • Chain 'K':
    Compound: 9-meric peptide from Spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02385 (0-8)
      • modified residue (0)
  • Chain 'L':
    Compound: 9-meric peptide from Spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02385 (0-8)
      • modified residue (0)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zokA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwerwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvqnycrvyhe
    glpepltlrwer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zokB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zokC (C:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwerwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokC (C:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngrtdspk
    ahvthhprkevtlrcwalgfypaditltwqldmelvetrpagdgtfqkwasvvvpleqny
    tcrvyheglpepltlrwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zokD (D:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokD (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zokE (E:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwerwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokE (E:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprtlrcwalgfypaditltwlvetrpagdgtfqkwasvvvqnytcrvyh
    eglpepltlrwer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zokF (F:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokF (F:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zokG (G:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwerwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokG (G:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhpkgevtlrcwalgfypaditltwqdmelvetrpagdgtfqkwasvvvpl
    gkeqnytcrvyheglpepltlrw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zokH (H:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zokH (H:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.