PDB entry 2zoh

View 2zoh on RCSB PDB site
Description: X-ray Crystal Structure of Photoactive Yellow Protein, Wild type, at 295K
Class: signaling protein
Keywords: PAS, LOV, PHOTORECEPTOR, LIGHT SENSOR, Chromophore, Photoreceptor protein, Receptor, Sensory transduction, SIGNALING PROTEIN
Deposited on 2008-05-20, released 2009-03-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.112
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
  Gene: PYP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOPe 2.08: d2zoha_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zohA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv