PDB entry 2zno

View 2zno on RCSB PDB site
Description: Human PPRR gamma ligand binding domain in complex with a synthetic agonist TIPP703
Class: Transcription
Keywords: NUCLEAR RECEPTOR, PROTEIN-LIGAND COMPLEX, PPAR, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2008-04-30, released 2009-05-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2znoa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2znob_
  • Heterogens: S44, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2znoA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znoA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    qeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytml
    aslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiav
    iilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehv
    qllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2znoB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znoB (B:)
    esadlralakhlydsyiksfpltkakarailtgdkspfviydmnslmmgedkikfskeva
    irifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdg
    vlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrp
    gllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikk
    tethpllqeiy