PDB entry 2zn9

View 2zn9 on RCSB PDB site
Description: Crystal structure of Ca2+-bound form of des3-20ALG-2
Class: Apoptosis
Keywords: PENTA-EF-HAND PROTEIN, CALCIUM BINDING PROTEIN, Apoptosis, Endoplasmic reticulum, Membrane, Nucleus, Polymorphism
Deposited on 2008-04-22, released 2008-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.237
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zn9a_
  • Chain 'B':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zn9b_
  • Heterogens: CA, 2PE, 12P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zn9A (A:)
    aalpdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkag
    vnfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfd
    rqgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zn9A (A:)
    alpdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagv
    nfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdr
    qgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zn9B (B:)
    aalpdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkag
    vnfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfd
    rqgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zn9B (B:)
    alpdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagv
    nfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdr
    qgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsi