PDB entry 2zm3

View 2zm3 on RCSB PDB site
Description: Complex Structure of Insulin-like Growth Factor Receptor and Isoquinolinedione Inhibitor
Class: transferase
Keywords: IGFR, protein-inhibitor complex, tyrosine kinase, ATP-binding, Cleavage on pair of basic residues, Disease mutation, Glycoprotein, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-04-10, released 2008-06-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08069 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.02: d2zm3a_
  • Chain 'B':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08069 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.02: d2zm3b_
  • Chain 'C':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08069 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.02: d2zm3c_
  • Chain 'D':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08069 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.02: d2zm3d_
  • Heterogens: 575, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zm3A (A:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zm3A (A:)
    sfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpenp
    vlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiye
    tdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvl
    rfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyys
    een
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zm3B (B:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zm3B (B:)
    sfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeap
    pslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyy
    rkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvm
    egglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zm3C (C:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zm3C (C:)
    sfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrplap
    pslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyy
    rkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvm
    egglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zm3D (D:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zm3D (D:)
    sfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrppsl
    skmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkg
    gkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegg
    lldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen