PDB entry 2zlx

View 2zlx on RCSB PDB site
Description: Horse methemoglobin high salt, pH 7.0 (66% relative humidity)
Class: Oxygen storage, Oxygen transport
Keywords: protein hydration, allosteric transitions, variability in quaternary structure, solvent content and crystal structure, water-mediated transformation, Heme, Iron, Metal-binding, Oxygen transport, Polymorphism, Transport, Oxygen storage
Deposited on 2008-04-10, released 2008-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.262
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-End)
      • conflict (81)
      • conflict (84)
    Domains in SCOPe 2.06: d2zlxa_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zlxb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-End)
      • conflict (81)
      • conflict (84)
    Domains in SCOPe 2.06: d2zlxc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zlxd_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zlxA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zlxA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltsky
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zlxB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zlxC (C:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zlxC (C:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltsk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zlxD (D:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh