PDB entry 2zky

View 2zky on RCSB PDB site
Description: Crystal structure of human Cu-Zn superoxide dismutase mutant G93A
Class: oxidoreductase
Keywords: oxidoreductase, human Cu-Zn superoxide dismutase, ALS, FALS, metal-binding, disease mutation, E.C.1.15.1.1, Amyotrophic lateral sclerosis, Antioxidant, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2008-03-31, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkya_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyd_
  • Chain 'E':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkye_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyf_
  • Chain 'G':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyg_
  • Chain 'H':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyh_
  • Chain 'I':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyi_
  • Chain 'J':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.07: d2zkyj_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zkyA (A:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyA (A:)
    tkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
    phfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvhe
    kaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zkyB (B:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyB (B:)
    tkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
    phfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvhe
    kaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zkyC (C:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zkyD (D:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyD (D:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zkyE (E:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyE (E:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zkyF (F:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyF (F:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zkyG (G:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyG (G:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zkyH (H:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyH (H:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2zkyI (I:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyI (I:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2zkyJ (J:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkyJ (J:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq