PDB entry 2zkh

View 2zkh on RCSB PDB site
Description: Human thrombopoietin neutralizing antibody TN1 FAB
Class: immune system
Keywords: thrombopoietin, fab fragment(antibody), immune system
Deposited on 2008-03-21, released 2009-03-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.195
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Monoclonal TN1 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZKH (0-End)
    Domains in SCOPe 2.06: d2zkhh1, d2zkhh2
  • Chain 'L':
    Compound: Monoclonal TN1 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZKH (0-End)
    Domains in SCOPe 2.06: d2zkhl1, d2zkhl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zkhH (H:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkhH (H:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvp
    sstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2zkhL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkhL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr