PDB entry 2zkc

View 2zkc on RCSB PDB site
Description: Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol Z
Class: transcription
Keywords: ERR gamma, BPA, nuclear receptor, TRANSCRIPTION, Activator, DNA-binding, Metal-binding, Nucleus, Transcription regulation, Zinc-finger
Deposited on 2008-03-14, released 2009-03-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62508
      • see remark 999 (243)
    Domains in SCOPe 2.06: d2zkca1
  • Heterogens: BPZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zkcA (A:)
    lgspeflnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladre
    lvviigwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimded
    qsklaglldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvl
    healqdyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    akvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkcA (A:)
    kpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfst
    lsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailq
    lvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedp
    rragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakc