PDB entry 2zjo

View 2zjo on RCSB PDB site
Description: Crystal structure of hepatitis C virus NS3 helicase with a novel inhibitor
Class: hydrolase
Keywords: PROTEIN-INHIBITOR COMPLEX, structure-based drug design, HYDROLASE
Deposited on 2008-03-07, released 2009-03-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Hepatitis C virus (isolate Taiwan) [TaxId:31645]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zjoa1, d2zjoa2
  • Heterogens: BHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zjoA (A:)
    masmtggqqmgvdfvpvesmettmrspvftdnssppavpqafqvahlhaptgsgkstkvp
    aayaaqgykvlvlnpsvaatlgfgaymskahgvdpnirtgvrtittgapitystygkfla
    dggcsggaydiimcdechstdsttilgigtvldqaetagarlvvlatatppgsvtvphpn
    ieeialsntgeipfygkaipietikggrhlifchskkkcdelaaklsalgihavayyrgl
    dvsvipasgnvvvvatdalmtgftgdfdsvidcntcvtqtvdfsldptftietttmpqda
    vsrsqrrgrtsrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyeltpaetsvrlra
    ylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqatvcaraqapp
    pswdqmwkcltrlkptlhgptpllyrlgavqnevtlthpitkyimacmsadlevvthhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zjoA (A:)
    nssppavpqafqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
    gvdpnirtgvrtittgapitystygkfladggcsggaydiimcdechstdsttilgigtv
    ldqaetagarlvvlatatppgsvtvphpnieeialsntgeipfygkaipietikggrhli
    fchskkkcdelaaklsalgihavayyrgldvsvipasgnvvvvatdalmtgftgdfdsvi
    dcntcvtqtvdfsldptftietttmpqdavsrsqrrgrtsrgrrgiyrfvtpgerpsgmf
    dssvlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahf
    lsqtkqagdnfpylvayqatvcaraqapppswdqmwkcltrlkptlhgptpllyrlgavq
    nevtlthpitkyimacmsadlevv