PDB entry 2zj9

View 2zj9 on RCSB PDB site
Description: X-ray crystal structure of AmpC beta-Lactamase (AmpC(D)) from an Escherichia coli with a Tripeptide Deletion (Gly286 Ser287 Asp288) on the H10 Helix
Class: hydrolase
Keywords: lactamase, Tripeptide Deletion, HYDROLASE
Deposited on 2008-02-29, released 2009-03-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AmpC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EET9 (0-354)
      • see remark 999 (210)
    Domains in SCOPe 2.06: d2zj9a_
  • Chain 'B':
    Compound: AmpC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EET9 (0-354)
      • see remark 999 (210)
    Domains in SCOPe 2.06: d2zj9b_
  • Heterogens: NA, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zj9A (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk
    lnhtwinvpsaeeknyawgyregkavhvspraldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiinnkialaarpvkpitpptp
    avraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zj9B (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk
    lnhtwinvpsaeeknyawgyregkavhvspraldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiinnkialaarpvkpitpptp
    avraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq