PDB entry 2zit

View 2zit on RCSB PDB site
Description: Structure of the eEF2-ExoA-NAD+ complex
Class: biosynthetic protein/transferase
Keywords: elongation factor, toxin, ADP-ribosylation, toxin-substrate complex, Cytoplasm, GTP-binding, Nucleotide-binding, Phosphoprotein, Protein biosynthesis, RNA-binding, rRNA-binding, Glycosyltransferase, NAD, Transferase, BIOSYNTHETIC PROTEIN/TRANSFERASE COMPLEX
Deposited on 2008-02-24, released 2008-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zita1, d2zita2, d2zita3, d2zita4, d2zita5
  • Chain 'B':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (1-206)
      • expression tag (0)
      • see remark 999 (8)
      • see remark 999 (116)
    Domains in SCOPe 2.06: d2zitb2, d2zitb3
  • Chain 'C':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zitc1, d2zitc2, d2zitc3, d2zitc4, d2zitc5
  • Chain 'D':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (1-206)
      • expression tag (0)
      • see remark 999 (8)
      • see remark 999 (116)
    Domains in SCOPe 2.06: d2zitd2, d2zitd3
  • Chain 'E':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zite1, d2zite2, d2zite3, d2zite4, d2zite5
  • Chain 'F':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (1-206)
      • expression tag (0)
      • see remark 999 (8)
      • see remark 999 (116)
    Domains in SCOPe 2.06: d2zitf2, d2zitf3
  • Heterogens: NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zitA (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zitA (A:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zitB (B:)
    aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zitC (C:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zitC (C:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zitD (D:)
    aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zitE (E:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zitE (E:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
    emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
    etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
    vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
    kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
    lkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlm
    lyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmg
    rfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknan
    dlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkispp
    vvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararim
    addygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifge
    emrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqa
    vggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmvfd
    hwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zitF (F:)
    aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpg