PDB entry 2zij

View 2zij on RCSB PDB site
Description: Crystal Structure of Human Lysozyme Expressed in E. coli.
Class: hydrolase
Keywords: HYDROLASE, Refolded Protein, Amyloid, Antimicrobial, Bacteriolytic enzyme, Disease mutation, Glycosidase, Polymorphism
Deposited on 2008-02-18, released 2009-01-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zija_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zijA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv