PDB entry 2zid

View 2zid on RCSB PDB site
Description: Crystal structure of dextran glucosidase E236Q complex with isomaltotriose
Class: hydrolase
Keywords: TIM barrel, (beta/alpha)8-barrel, Hydrolase
Deposited on 2008-02-14, released 2008-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dextran glucosidase
    Species: STREPTOCOCCUS MUTANS
    Gene: dexB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2HWU5 (5-535)
      • see remark 999 (0-4)
      • engineered (235)
      • engineered (535)
    Domains in SCOPe 2.06: d2zida1, d2zida2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zidA (A:)
    mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd
    ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds
    serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm
    nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgqtwga
    tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel
    gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp
    fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk
    twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvdadfellptadkvfaylr
    kvreerylivvnvsdqeevleidvdkqetlisntnesaalanhklqpwdafcikilehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zidA (A:)
    mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd
    ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds
    serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm
    nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgqtwga
    tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel
    gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp
    fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk
    twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvdadfellptadkvfaylr
    kvreerylivvnvsdqeevleidvdkqetlisntnesaalanhklqpwdafcikil