PDB entry 2zib

View 2zib on RCSB PDB site
Description: Crystal structure analysis of calcium-independent type II antifreeze protein
Class: antifreeze protein
Keywords: ANTIFREEZE PROTEIN, THERMAL HYSTERESIS, Lectin
Deposited on 2008-02-14, released 2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.133
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II antifreeze protein
    Species: Brachyopsis rostratus [TaxId:412977]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0ZT93 (6-132)
      • expression tag (3-5)
    Domains in SCOPe 2.08: d2ziba1, d2ziba2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zibA (A:)
    hhhhhhalvcpagwtlhgqrcfyseatamtwdlaeancvnkgghlasihsleeqlyikdi
    vagivwiggsackvagawswtdgtpvdyrtwcptkpndilsdccmqmtaavdkcwddlpc
    pashasicakaai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zibA (A:)
    hhhalvcpagwtlhgqrcfyseatamtwdlaeancvnkgghlasihsleeqlyikdivag
    ivwiggsackvagawswtdgtpvdyrtwcptkpndilsdccmqmtaavdkcwddlpcpas
    hasicakaai