PDB entry 2zfx

View 2zfx on RCSB PDB site
Description: Crystal structure of the rat vitamin D receptor ligand binding domain complexed with YR301 and a synthetic peptide containing the NR2 box of DRIP 205
Class: transcription
Keywords: hormone/growth factor receptor, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Zinc, Zinc-finger, Activator, Alternative splicing, Polymorphism
Deposited on 2008-01-15, released 2009-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-20, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zfxa_
  • Chain 'C':
    Compound: DRIP 205 NR2 box peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: YR3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zfxA (A:)
    gshmlkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldls
    plsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmd
    dmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspd
    rpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyr
    slsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zfxA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvigf
    akmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskag
    htlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlq
    tyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn
    e
    

  • Chain 'C':
    No sequence available.