PDB entry 2zfo

View 2zfo on RCSB PDB site
Description: Structure of the partially unliganded met state of 400 kDa hemoglobin: Insights into ligand-induced structural changes of giant hemoglobins
Class: oxygen binding, transport protein
Keywords: hemoglobin, polychaete, annelida, unliganded, Heme, Iron, Metal-binding, Oxygen transport, Secreted, Transport, OXYGEN BINDING, TRANSPORT PROTEIN
Deposited on 2008-01-08, released 2008-04-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Extracellular giant hemoglobin major globin subunit A1
  Species: Oligobrachia mashikoi [TaxId:55676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M419 (0-139)
  Domains in SCOPe 2.05: d2zfoa_
• Chain 'B':
  Compound: Extracellular giant hemoglobin major globin subunit A2
  Species: Oligobrachia mashikoi [TaxId:55676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M413 (0-141)
  Domains in SCOPe 2.05: d2zfob_
• Chain 'C':
  Compound: Extracellular giant hemoglobin major globin subunit B2
  Species: Oligobrachia mashikoi [TaxId:55676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M418 (0-146)
  Domains in SCOPe 2.05: d2zfoc_
• Chain 'D':
  Compound: Extracellular giant hemoglobin major globin subunit B1
  Species: Oligobrachia mashikoi [TaxId:55676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5KSB7 (0-144)
    • microheterogeneity (30)
    • microheterogeneity (37)
    • microheterogeneity (40)
    • microheterogeneity (56-58)
    • microheterogeneity (68)
    • microheterogeneity (96)
    • microheterogeneity (111)
    • microheterogeneity (130)
  Domains in SCOPe 2.05: d2zfod_
• Heterogens: HEM, OXY, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zfoA (A:)
  vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft
  ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld
  cfnqhawgecyeriasgisg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zfoB (B:)
  dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
  ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
  arsfdndawnscmnqivsgisg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zfoC (C:)
  ssccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpds
  adfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevm
  pqvsscfssdswnrcfariangisagl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zfoD (D:)
  eccsrgdaevvisewdqvfnaamagssesaigvaifdvfftssgvspsmfpgggdsssae
  flaqvsrvisgadiainsltnratcdsllshlnaqhkaisgvtgaavthlseaissvvaq
  vlpsahidawgycmayiaagigagl