PDB entry 2zfo

View 2zfo on RCSB PDB site
Description: Structure of the partially unliganded met state of 400 kDa hemoglobin: Insights into ligand-induced structural changes of giant hemoglobins
Class: oxygen binding, transport protein
Keywords: hemoglobin, polychaete, annelida, unliganded, Heme, Iron, Metal-binding, Oxygen transport, Secreted, Transport, OXYGEN BINDING, TRANSPORT PROTEIN
Deposited on 2008-01-08, released 2008-04-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extracellular giant hemoglobin major globin subunit A1
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zfoa_
  • Chain 'B':
    Compound: Extracellular giant hemoglobin major globin subunit A2
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zfob_
  • Chain 'C':
    Compound: Extracellular giant hemoglobin major globin subunit B2
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zfoc_
  • Chain 'D':
    Compound: Extracellular giant hemoglobin major globin subunit B1
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KSB7 (0-144)
      • microheterogeneity (30)
      • microheterogeneity (37)
      • microheterogeneity (40)
      • microheterogeneity (56-58)
      • microheterogeneity (68)
      • microheterogeneity (96)
      • microheterogeneity (111)
      • microheterogeneity (130)
    Domains in SCOPe 2.03: d2zfod_
  • Heterogens: HEM, OXY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zfoA (A:)
    vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft
    ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld
    cfnqhawgecyeriasgisg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zfoB (B:)
    dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
    ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
    arsfdndawnscmnqivsgisg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zfoC (C:)
    ssccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpds
    adfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevm
    pqvsscfssdswnrcfariangisagl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zfoD (D:)
    eccsrgdaevvisewdqvfnaamagssesaigvaifdvfftssgvspsmfpgggdsssae
    flaqvsrvisgadiainsltnratcdsllshlnaqhkaisgvtgaavthlseaissvvaq
    vlpsahidawgycmayiaagigagl