PDB entry 2zfe

View 2zfe on RCSB PDB site
Description: Crystal structure of bacteriorhodopsin-xenon complex
Class: proton transport
Keywords: hydrophobic cavity, Chromophore, Hydrogen ion transport, Ion transport, Membrane, Photoreceptor protein, Pyrrolidone carboxylic acid, Receptor, Retinal protein, Sensory transduction, Transmembrane, Transport, PROTON TRANSPORT
Deposited on 2007-12-31, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-09, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarium
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zfea_
  • Heterogens: RET, L3P, L2P, L1P, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zfeA (A:)
    mlellptavegvsqaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaitt
    lvpaiaftmylsmllgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgt
    ilalvgadgimigtglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpev
    astfkvlrnvtvvlwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsr
    aifgeaeapepsagdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zfeA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg