PDB entry 2ze0

View 2ze0 on RCSB PDB site
Description: Alpha-glucosidase GSJ
Class: hydrolase
Keywords: tim barrel, glucoside hydrolase, extremophile, hydrolase
Deposited on 2007-12-04, released 2007-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase
    Species: Geobacillus sp. [TaxId:258999]
    Gene: gsj
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ze0a1, d2ze0a2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ze0A (A:)
    mkktwwkegvayqiyprsfmdangdgigdlrgiiekldylvelgvdivwicpiyrspnad
    ngydisdyyaimdefgtmddfdellaqahrrglkvildlvinhtsdehpwfiesrssrdn
    pkrdwyiwrdgkdgrepnnwesifggsawqydertgqyylhifdvkqpdlnwensevrqa
    lyemvnwwldkgidgfridaishikkkpglpdlpnpkglkyvpsfaghmnqpgimeylre
    lkeqtfarydimtvgeangvtvdeaeqwvgeengvfnmifqfehlglwerradgsidvrr
    lkrtltkwqkglenrgwnalflenhdlprsvstwgndrdywaesakalgalyffmqgtpf
    iyqgqeigmtnvrfddirdyrdvsalrlyelerakgrtheeamtiiwktgrdnsrtpmqw
    sgasnagfttgtpwikvnenyrtinveaerrdpnsvwsfyrqmiqlrkanelfvygtydl
    llenhpsiyaytrtlgrdralvvvnlsdrpslyrydgfrlqssdlalsnypvrphknatr
    fklkpyearvyiwke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ze0A (A:)
    kktwwkegvayqiyprsfmdangdgigdlrgiiekldylvelgvdivwicpiyrspnadn
    gydisdyyaimdefgtmddfdellaqahrrglkvildlvinhtsdehpwfiesrssrdnp
    krdwyiwrdgkdgrepnnwesifggsawqydertgqyylhifdvkqpdlnwensevrqal
    yemvnwwldkgidgfridaishikkkpglpdlplkyvpsfaghmnqpgimeylrelkeqt
    farydimtvgeangvtvdeaeqwvgeengvfnmifqfehlglwerrasidvrrlkrtltk
    wqkglenrgwnalflenhdlprsvstwgndrdywaesakalgalyffmqgtpfiyqgqei
    gmtnvrfddirdyrdvsalriiwktgrdnsrtpmqwsgasnagfttgtpwikvnenyrti
    nveaerrdpnsvwsfyrqmiqlrkanelfvygtydlllenhpsiyaytrtlgrdralvvv
    nlsdrpslyrydgfrlqssdlalsnypvrphknatrfklkpyearvyiwke