PDB entry 2zch

View 2zch on RCSB PDB site
Description: Crystal structure of human prostate specific antigen complexed with an activating antibody
Class: immune system
Keywords: human PSA, kallikrein related peptidases, antibodies, prostate cancer, Glycoprotein, Hydrolase, Polymorphism, Protease, Secreted, Serine protease, Zymogen, IMMUNE SYSTEM
Deposited on 2007-11-08, released 2008-01-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.207
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody 8G8F5 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZCH (0-228)
  • Chain 'L':
    Compound: monoclonal antibody 8G8F5 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZCH (0-214)
    Domains in SCOPe 2.04: d2zchl1, d2zchl2
  • Chain 'P':
    Compound: Prostate-specific antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2zchp_
  • Heterogens: NDG, CL, PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2zchL (L:)
divltqspaslavslgqratisckasqsvdfdgdsymnwyqqkpgqppkllifaasnlas
giparlsgsgsgtdftlniqpveeedaatyycqqsnedpytfgggtkleikradaaptvs
ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkdeyerhnsytceathktstspivksfnr

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2zchP (P:)
ivggwecekhsqpwqvlvasrgravcggvlvhpqwvltaahcirnksvillgrhslfhpe
dtgqvfqvshsfphplydmsllknrflrpgddsshdlmllrlsepaeltdavkvmdlptq
epalgttcyasgwgsiepeefltpkklqcvdlhvisndvcaqvhpqkvtkfmlcagrwtg
gkstcsgdsggplvcngvlqgitswgsepcalperpslytkvvhyrkwikdtivanp