PDB entry 2zbs

View 2zbs on RCSB PDB site
Description: Crystal structure of human estrogen-related receptor gamma ligand binding domain apo form
Class: transcription
Keywords: ERR gamma, nuclear receptor, TRANSCRIPTION, apo form, Activator, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Polymorphism, Transcription regulation, Zinc, Zinc-finger
Deposited on 2007-10-27, released 2008-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.204
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62508 (Start-242)
      • see remark 999 (243)
    Domains in SCOPe 2.06: d2zbsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zbsA (A:)
    lgspeflnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladre
    lvviigwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimded
    qsklaglldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvl
    healqdyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    akvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zbsA (A:)
    kpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfst
    lsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailq
    lvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedp
    rragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakvc