PDB entry 2zbo

View 2zbo on RCSB PDB site
Description: Crystal structure of low-redox-potential cytochrom c6 from brown alga Hizikia fusiformis at 1.6 A resolution
Class: electron transport
Keywords: ELECTRON TRANSPORT, cytochrome c6, redox potential, brown alga, Heme, Iron, Metal-binding, Transit peptide
Deposited on 2007-10-26, released 2008-09-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Hizikia fusiformis [TaxId:74103]
    Gene: petJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zboa_
  • Chain 'C':
    Compound: cytochrome c6
    Species: Hizikia fusiformis [TaxId:74103]
    Gene: petJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zboc_
  • Chain 'E':
    Compound: cytochrome c6
    Species: Hizikia fusiformis [TaxId:74103]
    Gene: petJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zboe_
  • Chain 'G':
    Compound: cytochrome c6
    Species: Hizikia fusiformis [TaxId:74103]
    Gene: petJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zbog_
  • Chain 'I':
    Compound: cytochrome c6
    Species: Hizikia fusiformis [TaxId:74103]
    Gene: petJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zboi_
  • Chain 'K':
    Compound: cytochrome c6
    Species: Hizikia fusiformis [TaxId:74103]
    Gene: petJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zbok_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zboA (A:)
    adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
    fggrlsdddiedvasfvlsqsekswn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zboC (C:)
    adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
    fggrlsdddiedvasfvlsqsekswn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zboE (E:)
    adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
    fggrlsdddiedvasfvlsqsekswn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zboG (G:)
    adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
    fggrlsdddiedvasfvlsqsekswn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zboI (I:)
    adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
    fggrlsdddiedvasfvlsqsekswn
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zboK (K:)
    adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
    fggrlsdddiedvasfvlsqsekswn