PDB entry 2zay

View 2zay on RCSB PDB site
Description: Crystal structure of response regulator from Desulfuromonas acetoxidans
Class: signaling protein
Keywords: Structural genomics, NYSGXRC, target 11006u, response regulator, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, SIGNALING PROTEIN
Deposited on 2007-10-12, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Desulfuromonas acetoxidans [TaxId:281689]
    Gene: Dace_1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zaya_
  • Chain 'B':
    Compound: Response regulator receiver protein
    Species: Desulfuromonas acetoxidans [TaxId:281689]
    Gene: Dace_1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zayb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zayA (A:)
    mslaegkwwrimlvdtqlpalaasisalsqegfdiiqcgnaieavpvavkthphliitea
    nmpkisgmdlfnslkknpqtasipvialsgratakeeaqlldmgfidfiakpvnairlsa
    rikrvlkllyedlsappareghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zayA (A:)
    wwrimlvdtqlpalaasisalsqegfdiiqcgnaieavpvavkthphliiteanmpkisg
    mdlfnslkknpqtasipvialsgratakeeaqlldmgfidfiakpvnairlsarikrvlk
    lly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zayB (B:)
    mslaegkwwrimlvdtqlpalaasisalsqegfdiiqcgnaieavpvavkthphliitea
    nmpkisgmdlfnslkknpqtasipvialsgratakeeaqlldmgfidfiakpvnairlsa
    rikrvlkllyedlsappareghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zayB (B:)
    wwrimlvdtqlpalaasisalsqegfdiiqcgnaieavpvavkthphliiteanmpkisg
    mdlfnslkknpqtasipvialsgratakeeaqlldmgfidfiakpvnairlsarikrvlk
    lly