PDB entry 2z9t

View 2z9t on RCSB PDB site
Description: Crystal structure of the human beta-2 microglobulin mutant W60G
Class: immune system
Keywords: beta-2-microglobulin, tryptophan, glycine, amyloidosis, DRA, beta fibrils, Disease mutation, Glycation, Glycoprotein, Immune response, Immunoglobulin domain, MHC I, Pyrrolidone carboxylic acid, Secreted, IMMUNE SYSTEM
Deposited on 2007-09-26, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: NM_004048
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • initiating methionine (0)
      • engineered (60)
    Domains in SCOPe 2.08: d2z9ta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z9tA (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    gsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm