PDB entry 2z92

View 2z92 on RCSB PDB site
Description: Crystal structure of the Fab fragment of anti-ciguatoxin antibody 10C9 in complex with CTX3C_ABCDE
Class: immune system
Keywords: Immunoglobrin fold, IMMUNE SYSTEM
Deposited on 2007-09-14, released 2008-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-ciguatoxin antibody 10C9 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z92 (0-End)
    Domains in SCOPe 2.06: d2z92a1
  • Chain 'B':
    Compound: Anti-ciguatoxin antibody 10C9 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z92 (0-End)
    Domains in SCOPe 2.06: d2z92b1, d2z92b2
  • Heterogens: ENE, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z92A (A:)
    qllesgpdlvkpsqslsltctvtgysitsgynwhwirqfpgnklewmgyihyrgttnynt
    slksrisitrdssknqfflqlnsvttedtatyycacddfysdywgqgtivtvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z92A (A:)
    qllesgpdlvkpsqslsltctvtgysitsgynwhwirqfpgnklewmgyihyrgttnynt
    slksrisitrdssknqfflqlnsvttedtatyycacddfysdywgqgtivtvssakttpp
    svyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpss
    twpsetvtcnvahpasstkvdkkivp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z92B (B:)
    elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z92B (B:)
    elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr