PDB entry 2z90

View 2z90 on RCSB PDB site
Description: Crystal Structure of the Second Dps from Mycobacterium smegmatis
Class: DNA binding protein
Keywords: DNA-binding protein, quarternary assembly, ferroxidation, DNA binding protein
Deposited on 2007-09-13, released 2008-04-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.187
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Starvation-inducible DNA-binding protein or fine tangled pili major subunit
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_3242
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2z90a_
  • Chain 'B':
    Compound: Starvation-inducible DNA-binding protein or fine tangled pili major subunit
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_3242
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2z90b_
  • Chain 'C':
    Compound: Starvation-inducible DNA-binding protein or fine tangled pili major subunit
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_3242
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2z90c_
  • Chain 'D':
    Compound: Starvation-inducible DNA-binding protein or fine tangled pili major subunit
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_3242
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2z90d_
  • Heterogens: FE2, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z90A (A:)
    msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
    dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
    tirrvhdavdaedpstadllhglidglekqawlirsenrkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z90B (B:)
    msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
    dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
    tirrvhdavdaedpstadllhglidglekqawlirsenrkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z90B (B:)
    sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd
    faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt
    irrvhdavdaedpstadllhglidglekqawlirsenrkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z90C (C:)
    msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
    dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
    tirrvhdavdaedpstadllhglidglekqawlirsenrkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z90C (C:)
    sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd
    faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt
    irrvhdavdaedpstadllhglidglekqawlirsenrkv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z90D (D:)
    msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
    dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
    tirrvhdavdaedpstadllhglidglekqawlirsenrkv