SCOPe 2.01: Structural Classification of Proteins

PDB entry 2z6t

View 2z6t on RCSB PDB site
Description: Crystal structure of the ferric peroxo myoglobin
Class: oxygen binding
Keywords: X-ray-induced-photoreduction, peroxo, microspectrophotometer, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport, OXYGEN BINDING
Deposited on 2007-08-08, released 2007-11-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.131
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Myoglobin
Species: Physeter catodon [TaxId:9755]
Database cross-references and differences (RAF-indexed):
- Uniprot P02185 (0-End)
Domains in SCOPe 2.01: d2z6ta_
Heterogens: SO4, HEM, PER, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2z6tA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Sequence, based on observed residues (ATOM records): (download)

>2z6tA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy