PDB entry 2z6n

View 2z6n on RCSB PDB site
Description: Crystal Structure of Carbonmonoxy Hemoglobin D from the Aldabra Giant Tortoise, Geochelone gigantea
Class: transport protein
Keywords: HEMOGLOBIN D, REPTILIA, THE ALDABRA GIANT TORTOISE, Geochelone gigantea, Heme, Iron, Metal-binding, Oxygen transport, Transport, TRANSPORT PROTEIN
Deposited on 2007-08-04, released 2007-08-28
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-28, with a file datestamp of 2007-08-24.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.185
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin D subunit alpha
    Species: Dipsochelys dussumieri
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z6na1
  • Chain 'B':
    Compound: Hemoglobin A/D subunit beta
    Species: Dipsochelys dussumieri
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z6nb1
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z6nA (A:)
    mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
    kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
    vqvaydkflaavsavlaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z6nB (B:)
    vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv
    lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk
    eftpasqaawtklvnavahalalgyh