PDB entry 2z69

View 2z69 on RCSB PDB site
Description: Crystal Structure of the sensor domain of the transcriptional regulator DNR from Pseudomonas aeruginosa
Class: transcription regulator
Keywords: beta barrel, dimerization helix, TRANSCRIPTION REGULATOR
Deposited on 2007-07-24, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNR protein
    Species: Pseudomonas aeruginosa
    Gene: dnr
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51441 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d2z69a1, d2z69a2
  • Chain 'B':
    Compound: DNR protein
    Species: Pseudomonas aeruginosa
    Gene: dnr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z69b_
  • Chain 'C':
    Compound: DNR protein
    Species: Pseudomonas aeruginosa
    Gene: dnr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z69c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z69A (A:)
    gshmefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyyli
    sgcvkiyrltpegqekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkayl
    rqlqdntplalallaklstrlhqrideietlslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z69A (A:)
    gshmefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyyli
    sgcvkiyrltpilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrqlqd
    ntplalallaklstrlhqrideietlsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z69B (B:)
    gshmefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyyli
    sgcvkiyrltpegqekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkayl
    rqlqdntplalallaklstrlhqrideietlslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z69B (B:)
    mefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgc
    vkiyrltpegqekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrql
    qdntplalallaklstrlhqrideietlsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z69C (C:)
    gshmefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyyli
    sgcvkiyrltpegqekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkayl
    rqlqdntplalallaklstrlhqrideietlslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z69C (C:)
    hqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgcvkiyrl
    qekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrqlqdntplalal
    laklstrlhqreietlsl