PDB entry 2z54

View 2z54 on RCSB PDB site
Description: The Influence of I47A Mutation on Reduced Susceptibility to the Protease Inhibitor Lopinavir
Class: hydrolase
Keywords: Complex (Aspartic Protease/Inhibitor), Aspartic Protease, Resistant Strain, HYDROLASE
Deposited on 2007-06-28, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11682]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (46)
      • conflict (53)
    Domains in SCOPe 2.07: d2z54a_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11682]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (46)
      • conflict (53)
    Domains in SCOPe 2.07: d2z54b_
  • Heterogens: BME, AB1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z54A (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfvkvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z54B (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfvkvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf